PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 243aa    MW: 26365.4 Da    PI: 5.2032
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007503genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+q+G+++W+ I++ ++ gR++k+c++rw + 
      Lus10007503 13 KGSWSPQEDVALIKLVQQHGPRNWSMISSGIP-GRSGKSCRLRWCNQ 58
                     799*****************************.***********985 PP

2Myb_DNA-binding52.11.6e-1667109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed  +v+a+ ++G++ W+tI+r ++ gRt++ +k++w++ 
      Lus10007503  67 PFTPAEDAVIVRAHSLHGNK-WATISRLLP-GRTDNAIKNHWNST 109
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.498859IPR017930Myb domain
SuperFamilySSF466892.25E-3010106IPR009057Homeodomain-like
SMARTSM007179.3E-161261IPR001005SANT/Myb domain
PfamPF002492.5E-171358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-241466IPR009057Homeodomain-like
CDDcd001677.14E-151557No hitNo description
PROSITE profilePS5129425.33960114IPR017930Myb domain
SMARTSM007171.6E-1364112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2367113IPR009057Homeodomain-like
CDDcd001673.75E-1167110No hitNo description
PfamPF002491.4E-1367109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEPPSSSTAD RIKGSWSPQE DVALIKLVQQ HGPRNWSMIS SGIPGRSGKS CRLRWCNQLS  60
PDVQHRPFTP AEDAVIVRAH SLHGNKWATI SRLLPGRTDN AIKNHWNSTL RRKRAAGKNL  120
DFAVPSDSNL ADSEGESGSN KKLCLRLVDD DIGNGSEGEI ITTSLTLCPP GAEEDVAAEE  180
SGEKEKWLKA AAAAAAEEEE SCLLEIMQRM VADEVGSYID RLKAQDGLNL GPNPEPVDRH  240
DP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-39121133104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866980.14e-86PREDICTED: myb-related protein B-like
TrEMBLA0A067LKB38e-86A0A067LKB3_JATCU; MYB family protein
STRINGVIT_13s0067g01360.t011e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-57myb domain protein 73